
£125.00
LL-37 is the active, C-terminal fragment derived from the human cationic antimicrobial peptide 18 (hCAP18). It is a key effector molecule in host defense, found in neutrophils and epithelial cells.
This 37-amino-acid peptide (Sequence: [LL-37, 37 aa]) is renowned for its potent, broad-spectrum antimicrobial activity against a wide range of pathogens, including Gram-positive and Gram-negative bacteria, viruses, and fungi.
Beyond its direct antimicrobial effects, LL-37 is a multifunctional immunomodulator. It can influence inflammation, promote wound healing, stimulate angiogenesis, and chemoattract immune cells such as neutrophils and monocytes. Its complex role in the immune system makes it a valuable peptide for research in infectious diseases, immunology, and inflammatory conditions.
Product: LL-37 (Human)
Quantity: 10 mg
Format: Lyophilized Powder
Purity: Typically >95% (for research-grade products)
CAS Number: 154947-66-7
Explore our high-purity compounds — including Retatide (Retatrutide 30 mg), Semaglutide, and more.
Fast UK shipping. Lab-tested quality. Strictly for research use only.
Strictly for Research Use Only. Not for human or animal consumption.