High-purity peptides for Research use — fast UK delivery available.

LL37 – 10mg

LL37 – 10mg

£125.00

LL-37 is the active, C-terminal fragment derived from the human cationic antimicrobial peptide 18 (hCAP18). It is a key effector molecule in host defense, found in neutrophils and epithelial cells.

This 37-amino-acid peptide (Sequence: [LL-37, 37 aa]) is renowned for its potent, broad-spectrum antimicrobial activity against a wide range of pathogens, including Gram-positive and Gram-negative bacteria, viruses, and fungi.

Beyond its direct antimicrobial effects, LL-37 is a multifunctional immunomodulator. It can influence inflammation, promote wound healing, stimulate angiogenesis, and chemoattract immune cells such as neutrophils and monocytes. Its complex role in the immune system makes it a valuable peptide for research in infectious diseases, immunology, and inflammatory conditions.

  • Product: LL-37 (Human)

  • Quantity: 10 mg

  • Format: Lyophilized Powder

  • Purity: Typically >95% (for research-grade products)

  • CAS Number: 154947-66-7

Quick Payment

100% New

Fast Delivery

Ready to Start Your Research with Trusted Peptides?

Explore our high-purity compounds — including Retatide (Retatrutide 30 mg), Semaglutide, and more.
Fast UK shipping. Lab-tested quality. Strictly for research use only.